This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
TGFB3 polyclonal antibody
catalog :
PAB18938
quantity :
100 ug
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
restriction area :
Spain, Portugal
catalog id :
PAB18938
product name :
TGFB3 polyclonal antibody
product description :
Rabbit polyclonal antibody raised against recombinant TGFB3.
gene name :
TGFB3
gene alias :
ARVD FLJ16571 TGF-beta3
gene description :
transforming growth factor, beta 3
immunogen :
Recombinant protein corresponding to human TGFB3.
immunogen sequence protein sequence :
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGY
YANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCC
VPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
YANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCC
VPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
form :
Lyophilized
recommend dilutions :
Western Blot (1:500-1:1000). The optimal working dilution should be determined by the end user.
storage buffer :
Lyophilized from PBS
storage instruction :
Store at -20 C on dry atmosphere. After reconstitution with 100 uL distilled water, store at -20 C. Aliquot to avoid repeated freezing and thawing.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Re
size :
100 ug
autodate :
2011-04-15
updatetime :
2011-10-07 16:19:36
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
