This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
Dock4 polyclonal antibody
catalog :
PAB15726
quantity :
50 ug
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
mouse
application :
western blot
product information
catalog id :
PAB15726
product name :
Dock4 polyclonal antibody
product description :
Rabbit polyclonal antibody raised against partial recombinant Dock4.
gene name :
Dock4
gene alias :
5330406C03 6330411N01Rik AF263288 C030023J22 mKIAA0716
gene description :
dedicator of cytokinesis 4
immunogen :
Recombinant GST fusion protein corresponding to 254 mouse Dock4.
immunogen sequence protein sequence :
CLSPRDRPCSAIYPTPVEPSQRMLFNHIGDGALPRSDPN
LSAPEKAVNPTPSSWSLDSGKEAKNMSDSGKLISPPVPP
RPTQTASPARHTTSVSPSPAGRSPLKGSVQSFTPSPVEY
NSPGLSSNSPVLSGSYSSGISSLSRCSTSETSGFENQAN
EQSVPVPVPVPVPVPVPSFSGSEEPVRKESKTPPPYSVY
ERTLRRPVPLPHSLSIPVTSEPPALPPKPLAARSSHLEN
GTRRTEPGPRPRPLPRKVSQ
LSAPEKAVNPTPSSWSLDSGKEAKNMSDSGKLISPPVPP
RPTQTASPARHTTSVSPSPAGRSPLKGSVQSFTPSPVEY
NSPGLSSNSPVLSGSYSSGISSLSRCSTSETSGFENQAN
EQSVPVPVPVPVPVPVPSFSGSEEPVRKESKTPPPYSVY
ERTLRRPVPLPHSLSIPVTSEPPALPPKPLAARSSHLEN
GTRRTEPGPRPRPLPRKVSQ
protein accession :
AK122353
form :
Liquid
recommend dilutions :
Western Blot (1:1000). The optimal working dilution should be determined by the end user.
storage buffer :
In PBS (50% glycerol, 0.02% sodium azide)
storage instruction :
Store at -20 C. Aliquot to avoid repeated freezing and thawing.
note :
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Mouse
specificity :
Specific to recombinant protein GX0390. This antibody detects mDOCK4 protein.
species reactivity cross reactivity :
Mouse
application key :
WB
size :
50 ug
autodate :
2010-04-01
updatetime :
2011-11-08 15:09:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
