This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
GZMA (Human) Recombinant Protein
catalog :
P6169
quantity :
100 ug
product information
catalog id :
P6169
product name :
GZMA (Human) Recombinant Protein
product description :
Human GZMA (P12544) partial recombinant protein expressed in Pichia pastoris .
gene name :
GZMA
gene alias :
CTLA3 HFSP
gene description :
granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)
immunogen sequence protein sequence :
EKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVL
TAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYP
CYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVK
PGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDR
NHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGV
FRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKG
AV
TAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYP
CYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVK
PGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDR
NHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGV
FRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKG
AV
protein accession :
P12544
form :
Liquid
preparation method :
Pichia pastoris expression system
recommend dilutions :
SDS-PAGE. The optimal working dilution should be determined by the end user.
storage buffer :
In PBS
storage instruction :
Store at -20 C. For long term storage store at -80 C. Aliquot to avoid repeated freezing and thawing.
type clonality :
Protein
raised in host species :
Fungi
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
SDS-PAGE
size :
100 ug
autodate :
2014-08-29
updatetime :
2014-08-29 14:35:36
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
