This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
SERPINB2 (Human) Recombinant protein
catalog :
P6129
quantity :
10 ug
product information
catalog id :
P6129
product name :
SERPINB2 (Human) Recombinant protein
product description :
Human SERPINB2 (P05120) full-length recombinant protein expressed in Escherichia coli .
gene name :
SERPINB2
gene alias :
HsT1201 PAI PAI-2 PAI2 PLANH2
gene description :
serpin peptidase inhibitor, clade B (ovalbumin), member 2
immunogen sequence protein sequence :
MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTM
AMVYMGSRGSTEDQMAKVLQFNEVGANAVTPMTPENFTS
CGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINAS
TGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAV
DFLECAEEARKKINSWVKTQTKGKIPNLLPEGSVDGDTR
MVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQM
MYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIA
DVSTGLELLESEITYDKLNKWTSKDKMAEDEVEVYIPQF
KLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFL
SEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVA
DHPFLFLIMHKITNCILFFGRFSSP
AMVYMGSRGSTEDQMAKVLQFNEVGANAVTPMTPENFTS
CGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINAS
TGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAV
DFLECAEEARKKINSWVKTQTKGKIPNLLPEGSVDGDTR
MVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQM
MYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIA
DVSTGLELLESEITYDKLNKWTSKDKMAEDEVEVYIPQF
KLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFL
SEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVA
DHPFLFLIMHKITNCILFFGRFSSP
protein accession :
P05120
form :
Lyophilized
preparation method :
Escherichia coli expression system
recommend dilutions :
Activity assay. SDS-PAGE. The optimal working dilution should be determined by the end user.
storage buffer :
Lyophilized from 10 mM Tris (pH 8.0, 1 mM Cysteine).
storage instruction :
Store at -20 C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20 C to -80 C.
type clonality :
Protein
raised in host species :
Escherichia coli
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
Func,SDS-PAGE
size :
10 ug
autodate :
2014-02-27
updatetime :
2014-02-27 11:44:23
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
