This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
NAMPT (Human) Recombinant Protein
catalog :
P6055
quantity :
25 ug
product information
catalog id :
P6055
product name :
NAMPT (Human) Recombinant Protein
product description :
Human NAMPT (P43490) partial recombinant protein expressed in Escherichia coli .
gene name :
NAMPT
gene alias :
1110035O14Rik DKFZp666B131 MGC117256 PBEF PBEF1 VF VISFATIN
gene description :
nicotinamide phosphoribosyltransferase
immunogen sequence protein sequence :
MPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQY
ILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNY
ILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECY
WLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSG
NLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDT
VAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEK
DAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHL
IVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTEN
SKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSIE
NIAFGSGGGLLQKLTRDLLNCSFKCSYVVTNGLGINVFK
DPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYG
QDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAHH
ILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNY
ILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECY
WLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSG
NLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDT
VAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEK
DAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHL
IVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTEN
SKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSIE
NIAFGSGGGLLQKLTRDLLNCSFKCSYVVTNGLGINVFK
DPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYG
QDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAHH
protein accession :
P43490
form :
Lyophilized
preparation method :
Escherichia coli expression system
recommend dilutions :
Activity assay. SDS-PAGE. The optimal working dilution should be determined by the end user.
storage buffer :
Lyophilized from sterile 10 mM HCl
storage instruction :
Store at -20 C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL and keep it at low pH. Do not vortex. For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20 C to -80 C is recommended.
type clonality :
Protein
raised in host species :
Escherichia coli
antigen species target species :
Human
application key :
Func,SDS-PAGE
size :
25 ug
autodate :
2014-02-27
updatetime :
2014-02-27 11:44:23
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
