This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
IL28A (Human) Recombinant Protein
catalog :
P5985
quantity :
20 ug
product information
catalog id :
P5985
product name :
IL28A (Human) Recombinant Protein
product description :
Human IL28A (Q8IZJ0) partial recombinant protein expressed in Escherichia coli .
gene name :
IL28A
gene alias :
IFNL2 IL-28A
gene description :
interleukin 28A (interferon, lambda 2)
immunogen sequence protein sequence :
PVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALE
ESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELAL
TLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQP
QPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNL
FRLLTRDLNCVASGDLCV
ESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELAL
TLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQP
QPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNL
FRLLTRDLNCVASGDLCV
protein accession :
Q8IZJ0
form :
Lyophilized
preparation method :
Escherichia coli expression system
recommend dilutions :
Activity assay. SDS-PAGE. The optimal working dilution should be determined by the end user.
storage buffer :
Lyophilized from solutions contain no sodiun azide nor carrier protein
storage instruction :
Store at -20 C. Aliquot to avoid repeated freezing and thawing.
type clonality :
Protein
raised in host species :
Escherichia coli
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
Func,SDS-PAGE
size :
20 ug
autodate :
2014-02-05
updatetime :
2014-02-07 18:29:42
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
