This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
AHSG (Human) Recombinant Protein
catalog :
P5981
quantity :
50 ug
product information
catalog id :
P5981
product name :
AHSG (Human) Recombinant Protein
product description :
Human AHSG (P02765) partial recombinant protein expressed in HEK293 cells.
gene name :
AHSG
gene alias :
A2HS AHS FETUA HSGA
gene description :
alpha-2-HS-glycoprotein
immunogen sequence protein sequence :
B-Chain:. TVVQPSVGAAAGPVVPPCPGRIRHFKV
APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYK
HTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTP
VARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSS
PDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQ
NNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEA
TEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQT
QPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPA
GSPPDSHVL.
A-Chain:.
APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYK
HTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTP
VARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSS
PDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQ
NNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEA
TEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQT
QPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPA
GSPPDSHVL.
A-Chain:.
protein accession :
P02765
form :
Lyophilized
preparation method :
Mammalian cell (HEK293) expression system
recommend dilutions :
Activity assay. SDS-PAGE. The optimal working dilution should be determined by the end user.
storage buffer :
Lyophilized from solutions contain no sodiun azide nor carrier protein
storage instruction :
Store at -20 C. Aliquot to avoid repeated freezing and thawing.
type clonality :
Protein
raised in host species :
Human
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
Func,SDS-PAGE
size :
50 ug
autodate :
2014-02-05
updatetime :
2014-02-07 18:29:42
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
