This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
ANGPTL3 (Human) Recombinant Protein
catalog :
P5941
quantity :
50 ug
product information
catalog id :
P5941
product name :
ANGPTL3 (Human) Recombinant Protein
product description :
Human ANGPTL3 (Q9Y5C1) partial recombinant protein with His tag expressed in CHO cells.
gene name :
ANGPTL3
gene alias :
ANGPT5
gene description :
angiopoietin-like 3
immunogen sequence protein sequence :
SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGH
GLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKE
EEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKIL
LQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQD
NSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEP
TEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIY
NRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRI
DGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSN
YVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITG
NVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHD
ECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIK
STKMLIHPTDSESFEHHHHHHHH
GLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKE
EEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKIL
LQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQD
NSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEP
TEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIY
NRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRI
DGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSN
YVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITG
NVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHD
ECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIK
STKMLIHPTDSESFEHHHHHHHH
protein accession :
Q9Y5C1
form :
Lyophilized
preparation method :
Mammalian cell (CHO) expression system
recommend dilutions :
Activity assay. SDS-PAGE. The optimal working dilution should be determined by the end user.
storage buffer :
Lyophilized from solutions contain no sodiun azide nor carrier protein
storage instruction :
Store at -20 C. Aliquot to avoid repeated freezing and thawing.
tag :
His
type clonality :
Protein
raised in host species :
Hamster
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
Func,SDS-PAGE
size :
50 ug
autodate :
2014-02-05
updatetime :
2014-02-07 18:29:42
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
