This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
INHBB (Human) Recombinant Protein
catalog :
P5935
quantity :
5 ug
product information
catalog id :
P5935
product name :
INHBB (Human) Recombinant Protein
product description :
Human INHBB (P09529) partial recombinant protein expressed in Hi-5 (BTI-Tn-5B1-4) cells.
gene name :
INHBB
gene alias :
MGC157939
gene description :
inhibin, beta B
immunogen sequence protein sequence :
GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNY
CEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNS
CCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
CEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNS
CCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
protein accession :
P09529
form :
Lyophilized
preparation method :
Insect cell (Hi-5) expression system
recommend dilutions :
Activity assay. SDS-PAGE. The optimal working dilution should be determined by the end user.
storage buffer :
Lyophilized from solutions contain no sodiun azide nor carrier protein
storage instruction :
Store at -20 C. Aliquot to avoid repeated freezing and thawing.
type clonality :
Protein
raised in host species :
Insect
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
Func,SDS-PAGE
size :
5 ug
autodate :
2014-02-05
updatetime :
2014-02-11 15:03:17
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
