This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
MBL2 (Human) Recombinant Protein
catalog :
P5889
quantity :
100 ug
product information
catalog id :
P5889
product name :
MBL2 (Human) Recombinant Protein
product description :
Human MBL2 (NP_000233, 21a.a. - 248 a.a.) partial recombinant protein with N-terminal hexahistidine tag and a TEV cleavage site expressed in HEK293EBNA1 cells.
gene name :
MBL2
gene alias :
COLEC1 HSMBPC MBL MBP MBP1 MGC116832 MGC116833
gene description :
mannose-binding lectin (protein C) 2, soluble (opsonic defect)
genbank accession :
NM_000242
immunogen sequence protein sequence :
GSHHHHHHDYDIPSSENLYFQGSETVTCEDAQKTCPAVI
ACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGK
LGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKA
LQTEMARIKKWLTFSLGKQVGNKTNGEIMTFEKVKALCV
KFQASVATPRNAAENGAIQNLIKEEAGITDEKTEGQFVD
LTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPC
STSHLAVCEFPIAAA
ACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGK
LGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKA
LQTEMARIKKWLTFSLGKQVGNKTNGEIMTFEKVKALCV
KFQASVATPRNAAENGAIQNLIKEEAGITDEKTEGQFVD
LTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPC
STSHLAVCEFPIAAA
protein accession :
NP_000233
form :
Liquid
concentration :
175 ug/mL
preparation method :
Mammalian cell (HEK293EBNA1) expression system
storage buffer :
In PBS without preservative
storage instruction :
Store at -80 C. Aliquot to avoid repeated freezing and thawing.
quality control testing :
NuPAGE Stained with Coomassie Blue
tag :
His
type clonality :
Protein
raised in host species :
Human
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
SDS-PAGE
size :
100 ug
autodate :
2013-05-24
updatetime :
2013-10-18 18:48:00
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
