This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
VTA1 (Human) Recombinant Protein
catalog :
P5849
quantity :
100 ug
product information
catalog id :
P5849
product name :
VTA1 (Human) Recombinant Protein
product description :
Human VTA1 (NP_057569, 1 a.a. - 307 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli .
gene name :
VTA1
gene alias :
C6orf55 DRG-1 DRG1 FLJ27228 HSPC228 LIP5 My012 SBP1
gene description :
Vps20-associated 1 homolog (S. cerevisiae)
immunogen sequence protein sequence :
MGSSHHHHHHSSGLVPRGSHMGSHMAALAPLPPLPAQFK
SIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTP
ECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENY
ALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFG
ELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEE
DNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYT
GIQIPPGAHAPANTPAEVPHSTGVASNTIQPTPQTIPAI
DPALFNTISQGDVRLTPEDFARAQKYCKYAGSALQYEDV
STAVQNLQKALKLLTTGRE
SIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTP
ECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENY
ALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFG
ELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEE
DNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYT
GIQIPPGAHAPANTPAEVPHSTGVASNTIQPTPQTIPAI
DPALFNTISQGDVRLTPEDFARAQKYCKYAGSALQYEDV
STAVQNLQKALKLLTTGRE
form :
Liquid
preparation method :
Escherichia coli expression system
storage buffer :
In 20mM Tris-HCl buffer, pH 8.0 (2mM DTT, 10% glycerol, 200mM NaCl).
storage instruction :
Store at -20 C. For long term storage store at -80 C. Aliquot to avoid repeated freezing and thawing.
quality control testing :
3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
tag :
His
type clonality :
Protein
raised in host species :
Escherichia coli
antigen species target species :
Human
application key :
SDS-PAGE
size :
100 ug
autodate :
2012-11-02
updatetime :
2015-11-25 11:54:24
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
