This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
nfsB ( Escherichia coli ) Recombinant protein
catalog :
P4983
quantity :
100 ug
product information
catalog id :
P4983
product name :
nfsB ( Escherichia coli ) Recombinant protein
product description :
Escherichia coli nfsB (NP_415110, 1 a.a. - 217 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli .
gene name :
nfsB
gene alias :
ECK0570 JW0567 dprA nfnB nfsI ntr
gene description :
dihydropteridine reductase, NAD(P)H-dependent, oxygen-insensitive
immunogen sequence protein sequence :
MGSSHHHHHHSSGLVPRGSHMDIISVALKRHSTKAFDAS
KKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKA
RVAKSAAGNYVFNERKMLDASHVVVFCAKTAMDDVWLKL
VVDQEDADGRFATPEAKAANDKGRKFFADMHRKDLHDDA
EWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAE
FGLKEKGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITL
TEV
protein accession :
NP_415110
form :
Liquid
concentration :
1 mg/mL
preparation method :
Escherichia coli expression system
storage buffer :
In 20 mM Tris-HCl, 50 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol)
storage instruction :
Store at -20 C. For long term storage store at -80 C. Aliquot to avoid repeated freezing and thawing.
quality control testing :
15% SDS-PAGE Stained with Coomassie Blue
tag :
His
type clonality :
Protein
raised in host species :
Escherichia coli
antigen species target species :
Escherichia coli
application key :
SDS-PAGE
size :
100 ug
autodate :
2011-10-28
updatetime :
2013-10-18 18:48:00
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098