This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
MET (Y1230C) (Human) Recombinant Protein
catalog :
P4828
quantity :
100 ug
product information
catalog id :
P4828
product name :
MET (Y1230C) (Human) Recombinant Protein
product description :
Human MET (NM_000245.2, 956 a.a. - 1390 a.a.) Y1230C mutant partial protein expressed in Sf9 cells.
gene name :
MET
gene alias :
AUTS9 HGFR RCCP2 c-Met
gene description :
met proto-oncogene (hepatocyte growth factor receptor)
immunogen sequence protein sequence :
KKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTE
MVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSP
ILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIG
PSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKS
LNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSE
GSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVA
KGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARD
MCDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVW
SFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPE
YCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFI
GEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPA
SFWETS
MVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSP
ILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIG
PSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKS
LNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSE
GSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVA
KGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARD
MCDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVW
SFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPE
YCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFI
GEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPA
SFWETS
protein accession :
NM_000245.2
form :
Liquid
concentration :
0.526 ug/uL
preparation method :
Insect cell (Sf9) expression system
storage buffer :
In 50 mM Hepes, 100 mM NaCl, pH 7.5 (5 mM DTT, 15 mM reduced glutathione, 20% glycerol)
storage instruction :
Store at -80 C. Aliquot to avoid repeated freezing and thawing
quality control testing :
2 ug/lane SDS-PAGE Stained with Coomassie Blue
note :
Result of activity analysis
type clonality :
Protein
raised in host species :
Insect
antigen species target species :
Human
application key :
Func,SDS-PAGE
size :
100 ug
autodate :
2011-10-28
updatetime :
2013-10-18 18:48:00
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
