This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
IL25 (Human) Recombinant Protein
catalog :
P4408
quantity :
25 ug
product information
catalog id :
P4408
product name :
IL25 (Human) Recombinant Protein
product description :
Human IL25 (Q9H293) recombinant protein expressed in Escherichia coli .
gene name :
IL25
gene alias :
IL-17E IL-25 IL17E
gene description :
interleukin 25
immunogen sequence protein sequence :
MYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRH
PESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHAR
CLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGE
KGTHKGYCLERRLYRVSLACVCVRPRVMG
PESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHAR
CLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGE
KGTHKGYCLERRLYRVSLACVCVRPRVMG
protein accession :
Q9H293
form :
Lyophilized
preparation method :
Escherichia coli expression system
storage buffer :
No additive
storage instruction :
Store at -20 C on dry atmosphere. After reconstitution with sterilized 10 mM HCl, store at -20 C or lower. Aliquot to avoid repeated freezing and thawing.
note :
Result of activity analysis
type clonality :
Protein
raised in host species :
Escherichia coli
antigen species target species :
Human
application key :
Func,SDS-PAGE
size :
25 ug
autodate :
2011-09-02
updatetime :
2017-04-05 15:59:20
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
