This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
FGF21 (Human) Recombinant Protein
catalog :
P4382
quantity :
20 ug
product information
catalog id :
P4382
product name :
FGF21 (Human) Recombinant Protein
product description :
Human FGF21 (Q9NSA1) recombinant protein expressed in Escherichia coli .
gene name :
FGF21
gene alias :
-
gene description :
fibroblast growth factor 21
immunogen sequence protein sequence :
MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIRED
GTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQR
PDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPL
HLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAP
QPPDVGSSDPLSMVGPSQGRSPSYAS
GTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQR
PDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPL
HLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAP
QPPDVGSSDPLSMVGPSQGRSPSYAS
protein accession :
Q9NSA1
form :
Lyophilized
preparation method :
Escherichia coli expression system
storage buffer :
Lyophilized from 10 mM Na 2 PO 4 , 100 mM NaCl, pH 7.5
storage instruction :
Store at -20 C on dry atmosphere. After reconstitution with sterilized water, store at -20 C or lower. Aliquot to avoid repeated freezing and thawing.
type clonality :
Protein
raised in host species :
Escherichia coli
antigen species target species :
Human
application key :
Func,SDS-PAGE
size :
20 ug
autodate :
9/2/11
updatetime :
2/26/21 10:57
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
