This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
RBP4 (Human) Recombinant Protein
catalog :
P4169
quantity :
20 ug
product information
catalog id :
P4169
product name :
RBP4 (Human) Recombinant Protein
product description :
Human RBP4 (P02753, 184 amino acids) partial recombinant protein expressed in Escherichia coli .
gene name :
RBP4
gene alias :
-
gene description :
retinol binding protein 4, plasma
immunogen sequence protein sequence :
MERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQ
DNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTF
TDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAV
QYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQR
QEELCLARQYRLIVHNGYCDGRSERNLL
DNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTF
TDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAV
QYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQR
QEELCLARQYRLIVHNGYCDGRSERNLL
protein accession :
P02753
form :
Liquid
preparation method :
Escherichia coli expression system
storage buffer :
In 1X PBS, pH 7.4
storage instruction :
Store at -20 C. Aliquot to avoid repeated freezing and thawing.
type clonality :
Protein
raised in host species :
Escherichia coli
antigen species target species :
Human
application key :
Func,SDS-PAGE
size :
20 ug
autodate :
2011-07-29
updatetime :
2015-03-18 16:45:27
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
