This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
APOE (Human) Recombinant Protein
catalog :
P4123
quantity :
50 ug
product information
catalog id :
P4123
product name :
APOE (Human) Recombinant Protein
product description :
Human APOE (NP_000032.1, 299 amino acids) partial recombinant protein expressed in Escherichia coli .
gene name :
APOE
gene alias :
AD2 LPG MGC1571 apoprotein
gene description :
apolipoprotein E
genbank accession :
NM_000041
immunogen sequence protein sequence :
MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLR
WVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSE
LEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLV
QYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDL
QKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAAT
VGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVK
EQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDM
QRQWAGLVEKVQAAVGTSAAPVPSDNH
WVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSE
LEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLV
QYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDL
QKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAAT
VGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVK
EQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDM
QRQWAGLVEKVQAAVGTSAAPVPSDNH
protein accession :
NP_000032.1
form :
Lyophilized
preparation method :
Escherichia coli expression system
storage buffer :
Lyophilized from 20mM sodium phosphate
storage instruction :
Store at -20 C on dry atmosphere. After reconstitution with 5 mM sodium phosphate pH 7.8 containing 0.5 mM DTT, store at -20 C. Aliquot to avoid repeated freezing and thawing.
type clonality :
Protein
raised in host species :
Escherichia coli
antigen species target species :
Human
application key :
SDS-PAGE
size :
50 ug
autodate :
2011-07-29
updatetime :
2015-03-18 16:45:27
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
