This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
PTH (Human) Recombinant Protein
catalog :
P3663
quantity :
100 ug
product information
catalog id :
P3663
product name :
PTH (Human) Recombinant Protein
product description :
Human PTH (P01270, 32 a.a. - 115 a.a.) partial recombinant protein expressed in Escherichia coli .
gene name :
PTH
gene alias :
PTH1
gene description :
parathyroid hormone
immunogen sequence protein sequence :
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGA
PLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVL
TKAKSQ
PLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVL
TKAKSQ
protein accession :
P01270
form :
Lyophilized
preparation method :
Escherichia coli expression system
storage buffer :
Lyophilized from PB
storage instruction :
Store at -20 C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 C for 1 month or store at -20 C for 6 months. Aliquot to avoid repeated freezing and thawing.
type clonality :
Protein
raised in host species :
Escherichia coli
antigen species target species :
Human
application key :
Func,SDS-PAGE
size :
100 ug
autodate :
2011-05-27
updatetime :
2015-08-06 18:15:15
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
