This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
PPBP (Human) Recombinant Protein
catalog :
P3656
quantity :
10 ug
product information
catalog id :
P3656
product name :
PPBP (Human) Recombinant Protein
product description :
Human PPBP (P02775, 59 a.a. - 128 a.a.) partial recombinant protein expressed in Escherichia coli .
gene name :
PPBP
gene alias :
B-TG1 Beta-TG CTAP-III CTAP3 CTAPIII CXCL7 LA-PF4 LDGF MDGF NAP-2 PBP SCYB7 TC1 TC2 TGB TGB1 THBGB THBGB1
gene description :
pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)
immunogen sequence protein sequence :
AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIAT
LKDGRKICLDPDAPRIKKIVQKKLAGDESAD
LKDGRKICLDPDAPRIKKIVQKKLAGDESAD
protein accession :
P02775
form :
Lyophilized
preparation method :
Escherichia coli expression system
storage buffer :
Lyophilized from 20 mM PB, 100 mM NaCl, pH 7.5
storage instruction :
Store at -20 C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 C for 1 month or store at -20 C for 6 months. Aliquot to avoid repeated freezing and thawing.
type clonality :
Protein
raised in host species :
Escherichia coli
antigen species target species :
Human
application key :
Func,SDS-PAGE
size :
10 ug
autodate :
2011-05-27
updatetime :
2015-08-06 18:15:15
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
