This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
LGALS4 (Human) Recombinant Protein
catalog :
P3544
quantity :
100 ug
product information
catalog id :
P3544
product name :
LGALS4 (Human) Recombinant Protein
product description :
Human LGALS4 (NP_006140, 1 a.a. - 323 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli .
gene name :
LGALS4
gene alias :
GAL4 L36LBP
gene description :
lectin, galactoside-binding, soluble, 4
immunogen sequence protein sequence :
MGSSHHHHHHSSGLVPRGSHMAYVPAPGYQPTYNPTLPY
YQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGS
DVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKK
GAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHL
QVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQ
LNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYV
PPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLN
GSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQ
HLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
YQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGS
DVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKK
GAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHL
QVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQ
LNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYV
PPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLN
GSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQ
HLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
protein accession :
NP_006140
form :
Liquid
concentration :
1 mg/mL
preparation method :
Escherichia coli expression system
storage buffer :
In 20 mM Tris-HCl buffer, pH 8.0 (1 mM DTT, 10% glycerol).
storage instruction :
Store at 2 C to 8 C for 1 week. For long term storage, aliquot and store at -20 C to -80 C. Aliquot to avoid repeated freezing and thawing.
quality control testing :
Loading 3 ug protein in 15% SDS-PAGE
tag :
His
type clonality :
Protein
raised in host species :
Escherichia coli
antigen species target species :
Human
application key :
SDS-PAGE
size :
100 ug
autodate :
5/27/11
updatetime :
3/26/20 15:42
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
