This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
SULT2A1 (Human) Recombinant Protein
catalog :
P3441
quantity :
100 ug
product information
catalog id :
P3441
product name :
SULT2A1 (Human) Recombinant Protein
product description :
Human SULT2A1 (NP_003158, 1 a.a. - 285 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli .
gene name :
SULT2A1
gene alias :
DHEA-ST DHEAS HST ST2 ST2A3 STD hSTa
gene description :
sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1
immunogen sequence protein sequence :
MGSSHHHHHHSSGLVPRGSHMSDDFLWFEGIAFPTMGFR
SETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMH
SKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFS
SHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKN
MKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMRE
EKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLI
LKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGD
WKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
SETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMH
SKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFS
SHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKN
MKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMRE
EKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLI
LKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGD
WKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
protein accession :
NP_003158
form :
Liquid
concentration :
1 mg/mL
preparation method :
Escherichia coli expression system
storage buffer :
In 20 mM Tris-HCl, 0.1M NaCl, pH 8.0 (1 mM dithiothreitol, 20% glycerol)
storage instruction :
Store at 4 C for 1-2 weeks. For long term storage store at -20 C or -80 C. Aliquot to avoid repeated freezing and thawing.
quality control testing :
Loading 3 ug protein in 15% SDS-PAGE
tag :
His
type clonality :
Protein
raised in host species :
Escherichia coli
antigen species target species :
Human
application key :
SDS-PAGE
size :
100 ug
autodate :
2011-05-27
updatetime :
2013-10-18 18:48:00
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
