This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
IL18 (Human) Recombinant Protein
catalog :
P3390
quantity :
100 ug
product information
catalog id :
P3390
product name :
IL18 (Human) Recombinant Protein
product description :
Human IL18 (NP_001553, 37 a.a. - 193 a.a. ) partial recombinant protein expressed in Escherichia coli .
gene name :
IL18
gene alias :
IGIF IL-18 IL-1g IL1F4 MGC12320
gene description :
interleukin 18 (interferon-gamma-inducing factor)
immunogen sequence protein sequence :
MYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDC
RDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCE
NKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFE
SSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQN
ED
RDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCE
NKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFE
SSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQN
ED
protein accession :
NP_001553
form :
Liquid
concentration :
1 mg/mL
preparation method :
Escherichia coli expression system
storage buffer :
In PBS, pH 7.4
storage instruction :
Store at 4 C for 1-2 weeks. For long term storage store at -20 C or -80 C. Aliquot to avoid repeated freezing and thawing.
quality control testing :
Loading 3 ug protein in 15% SDS-PAGE
type clonality :
Protein
raised in host species :
Escherichia coli
antigen species target species :
Human
application key :
SDS-PAGE
size :
100 ug
autodate :
2011-05-27
updatetime :
2013-10-18 18:48:00
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
