This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
TGFB2 (Human) Recombinant Protein, Active
catalog :
P3378
quantity :
5 ug
product information
restriction area :
Spain, Portugal
catalog id :
P3378
product name :
TGFB2 (Human) Recombinant Protein, Active
product description :
Human TGFB2 (two 118 amino acids) recombinent protein with His tag expressed in Nicotiana benthamiana .
gene name :
TGFB2
gene alias :
MGC116892 TGF-beta2
gene description :
transforming growth factor, beta 2
immunogen sequence protein sequence :
HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWI
HEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEA
SASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKC
S
HEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEA
SASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKC
S
form :
Lyophilized
preparation method :
Non-transgenic plants ( Nicotiana benthamiana ) expression system
storage buffer :
Lyophilized from 0.05 M Tris-HCl, pH 7.4.
storage instruction :
Store at -20 C. After reconstitution with sterilized water, store at -20 C. Aliquot to avoid repeated freezing and thawing.
quality control testing :
15% SDS-PAGE Stained with Coomassie Blue
note :
Result of activity analysis
tag :
His
type clonality :
Protein
raised in host species :
Plants
antigen species target species :
Human
application key :
WB-Re,Func,SDS-PAGE
size :
5 ug
autodate :
2011-04-15
updatetime :
2016-06-30 11:07:18
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
