This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
FCGRT monoclonal antibody, clone CL3638
catalog :
MAB15812
quantity :
100 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human
application :
immunohistochemistry - paraffin section
product information
catalog id :
MAB15812
product name :
FCGRT monoclonal antibody, clone CL3638
product description :
Mouse monoclonal antibody raised against partial recombinant human FCGRT.
clone name :
CL3638
isotype :
IgG2a
gene name :
FCGRT
gene alias :
FCRN alpha-chain
gene description :
Fc fragment of IgG, receptor, transporter, alpha
immunogen :
Recombinant protein corresponding to human FCGRT.
immunogen sequence protein sequence :
LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSS
PGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPN
SDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELE
SPAKS
PGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPN
SDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELE
SPAKS
protein accession :
P55899
form :
Liquid
recommend dilutions :
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500). The optimal working dilution should be determined by the end user.
storage buffer :
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
storage instruction :
Store at 4 C. For long term storage store at -20 C. Aliquot to avoid repeated freezing and thawing.
note :
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IHC-P
size :
100 uL
autodate :
2017-06-30
updatetime :
2017-06-30 10:41:30
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
