This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
HSP90B1 monoclonal antibody, clone CL2647
catalog :
MAB15763
quantity :
100 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
CL2647
The same clone is also sold as:
The same clone is also sold as:
- Invitrogen: MA5-34994
- Abcam: ab210960
- Novus Biologicals: NBP2-42379
reactivity :
human
application :
western blot, immunocytochemistry, immunohistochemistry - paraffin section
product information
catalog id :
MAB15763
product name :
HSP90B1 monoclonal antibody, clone CL2647
product description :
Mouse monoclonal antibody raised against partial recombinant human HSP90B1.
clone name :
CL2647
isotype :
IgG2b
gene name :
HSP90B1
gene alias :
ECGP GP96 GRP94 TRA1
gene description :
heat shock protein 90kDa beta (Grp94), member 1
immunogen :
Recombinant protein corresponding to human HSP90B1.
immunogen sequence protein sequence :
SGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPL
IRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYLLPDT
KAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDTT
EDTEQDEDEEMDVGTDEEEETAKESTA
IRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYLLPDT
KAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDTT
EDTEQDEDEEMDVGTDEEEETAKESTA
protein accession :
P14625
form :
Liquid
recommend dilutions :
Immunofluorescence (1-4 ug/mL). Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:5000-1:10000). Western Blot (1:500-1:1000). The optimal working dilution should be determined by the end user.
storage buffer :
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
storage instruction :
Store at 4 C. For long term storage store at -20 C. Aliquot to avoid repeated freezing and thawing.
note :
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IHC-P,IF
size :
100 uL
autodate :
2017-06-30
updatetime :
2017-06-30 10:41:30
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
