This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PHGDH monoclonal antibody, clone CL0555
catalog :
MAB15639
quantity :
100 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
CL0555
The same clone is also sold as:
The same clone is also sold as:
- Novus Biologicals: NBP2-52939
- Invitrogen: MA5-31357
- Abcam: ab236763
reactivity :
human
application :
western blot, immunohistochemistry - paraffin section
product information
catalog id :
MAB15639
product name :
PHGDH monoclonal antibody, clone CL0555
product description :
Mouse monoclonal antibody raised against partial recombinant human PHGDH.
clone name :
CL0555
isotype :
IgG1
gene name :
PHGDH
gene alias :
3-PGDH 3PGDH MGC3017 PDG PGAD PGD PGDH SERA
gene description :
phosphoglycerate dehydrogenase
immunogen :
Recombinant protein corresponding to human PHGDH.
immunogen sequence protein sequence :
LEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRV
VNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDR
ALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDM
VNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDR
ALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDM
protein accession :
O43175
form :
Liquid
recommend dilutions :
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000). Western Blot (1:500-1:1000). The optimal working dilution should be determined by the end user.
storage buffer :
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
storage instruction :
Store at 4 C. For long term storage store at -20 C. Aliquot to avoid repeated freezing and thawing.
note :
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IHC-P
size :
100 uL
autodate :
2017-06-02
updatetime :
2017-06-02 10:22:32
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
