This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SFTPA1 monoclonal antibody (M04), clone 3E3
catalog :
H00653509-M04
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3.00E+03
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00653509-M04
product name :
SFTPA1 monoclonal antibody (M04), clone 3E3
product description :
Mouse monoclonal antibody raised against a full-length recombinant SFTPA1.
clone name :
3.00E+03
isotype :
IgG1 Kappa
gene name :
SFTPA1
gene alias :
COLEC4 FLJ51913 SFTP1 SP-A SP-A1
gene description :
surfactant protein A1
genbank accession :
NM_001164646.1
immunogen :
SFTPA1 (NP_001158118.1, 83 a.a. ~ 199 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEE
NEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYT
NWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
NEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYT
NWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
protein accession :
NP_001158118.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
100 ug
autodate :
9/20/10
updatetime :
11/15/13 18:46
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
