This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
NEGR1 monoclonal antibody (M01), clone 2A8
catalog :
H00257194-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2A8
reactivity :
human
product information
catalog id :
H00257194-M01
product name :
NEGR1 monoclonal antibody (M01), clone 2A8
product description :
Mouse monoclonal antibody raised against a partial recombinant NEGR1.
clone name :
2A8
isotype :
IgG2a Kappa
gene name :
NEGR1
gene alias :
DMML2433 IGLON4 KILON MGC46680 Ntra
gene description :
neuronal growth regulator 1
genbank accession :
NM_173808
immunogen :
NEGR1 (NP_776169, 228 a.a. ~ 327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
QEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFN
GQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGT
TNASLPLNPPSTAQYGITGSAD
GQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGT
TNASLPLNPPSTAQYGITGSAD
protein accession :
NP_776169
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA
size :
100 ug
autodate :
10/25/06
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
