This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
SGOL1 (Human) Recombinant Protein (P01)
catalog :
H00151648-P01
quantity :
2 ug
product information
catalog id :
H00151648-P01
product name :
SGOL1 (Human) Recombinant Protein (P01)
product description :
Human SGOL1 full-length ORF ( AAH17867, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.
gene name :
SGOL1
gene alias :
NY-BR-85 SGO Sgo1
gene description :
shugoshin-like 1 (S. pombe)
genbank accession :
BC017867
immunogen sequence protein sequence :
MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSF
IAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEA
QDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEI
CSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQ
IEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKK
NKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLC
FLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREF
VSRFPDCRKCKLETHICLR
IAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEA
QDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEI
CSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQ
IEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKK
NKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLC
FLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREF
VSRFPDCRKCKLETHICLR
protein accession :
AAH17867
preparation method :
in vitro wheat germ expression system
storage buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
storage instruction :
Store at -80 C. Aliquot to avoid repeated freezing and thawing.
quality control testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
note :
Best use within three months from the date of receipt of this protein.
tag :
GST
type clonality :
Protein
raised in host species :
Wheat Germ (in vitro)
antigen species target species :
Human
application key :
AP,Array,ELISA,WB-Re
size :
2 ug
autodate :
2006-10-10
updatetime :
2013-10-18 18:58:29
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
