SGOL1 monoclonal antibody (M01), clone 3C11 | Abnova H00151648-M01 product information

product summary

company name :

Abnova

product type :

antibody

product name :

SGOL1 monoclonal antibody (M01), clone 3C11

catalog :

H00151648-M01

quantity :

100 ug

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3C11

reactivity :

human, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation

more info or order :

Abnova product webpage

citations: 12

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry; human; 1:1000; loading ...; fig 2c	Vallardi G, Allan L, Crozier L, Saurin A. Division of labour between PP2A-B56 isoforms at the centromere and kinetochore. elife. 2019;8: pubmed publisher
immunocytochemistry; human; 1:100	Zielinska A, Holubcová Z, Blayney M, Elder K, Schuh M. Sister kinetochore splitting and precocious disintegration of bivalents could explain the maternal age effect. elife. 2015;4:e11389 pubmed publisher
immunocytochemistry; human; fig 2	Asghar A, Lajeunesse A, Dulla K, Combes G, Thebault P, Nigg E, et al. Bub1 autophosphorylation feeds back to regulate kinetochore docking and promote localized substrate phosphorylation. Nat Commun. 2015;6:8364 pubmed publisher
immunocytochemistry; human; 1:2000	Nijenhuis W, Vallardi G, Teixeira A, Kops G, Saurin A. Negative feedback at kinetochores underlies a responsive spindle checkpoint signal. Nat Cell Biol. 2014;16:1257-64 pubmed publisher
	Garcia Cruz R, Brieño M, Roig I, Grossmann M, Velilla E, Pujol A, et al. Dynamics of cohesin proteins REC8, STAG3, SMC1 beta and SMC3 are consistent with a role in sister chromatid cohesion during meiosis in human oocytes. Hum Reprod. 2010;25:2316-27 pubmed publisher
	Nozawa R, Nagao K, Masuda H, Iwasaki O, Hirota T, Nozaki N, et al. Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation. Nat Cell Biol. 2010;12:719-27 pubmed publisher
	Shouse G, Nobumori Y, Liu X. A B56gamma mutation in lung cancer disrupts the p53-dependent tumor-suppressor function of protein phosphatase 2A. Oncogene. 2010;29:3933-41 pubmed publisher
	Wang L, Mayer B, Stemmann O, Nigg E. Centromere DNA decatenation depends on cohesin removal and is required for mammalian cell division. J Cell Sci. 2010;123:806-13 pubmed publisher
	Hayashi Takanaka Y, Yamagata K, Nozaki N, Kimura H. Visualizing histone modifications in living cells: spatiotemporal dynamics of H3 phosphorylation during interphase. J Cell Biol. 2009;187:781-90 pubmed publisher
	Thein K, Kleylein Sohn J, Nigg E, Gruneberg U. Astrin is required for the maintenance of sister chromatid cohesion and centrosome integrity. J Cell Biol. 2007;178:345-54 pubmed
	Fu G, Ding X, Yuan K, Aikhionbare F, Yao J, Cai X, et al. Phosphorylation of human Sgo1 by NEK2A is essential for chromosome congression in mitosis. Cell Res. 2007;17:608-18 pubmed
	Dai J, Sullivan B, Higgins J. Regulation of mitotic chromosome cohesion by Haspin and Aurora B. Dev Cell. 2006;11:741-50 pubmed

product information

catalog id :

H00151648-M01

product name :

SGOL1 monoclonal antibody (M01), clone 3C11

product description :

Mouse monoclonal antibody raised against a full length recombinant SGOL1.

clone name :

3C11

isotype :

IgG2a Kappa

gene name :

SGOL1

gene alias :

NY-BR-85 SGO Sgo1

gene description :

shugoshin-like 1 (S. pombe)

genbank accession :

BC017867

immunogen :

SGOL1 (AAH17867, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

immunogen sequence protein sequence :

MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSF
IAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEA
QDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEI
CSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQ
IEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKK
NKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLC
FLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREF
VSRFPDCRKCKLETHICLR

protein accession :

AAH17867

storage buffer :

In 1x PBS, pH 7.4

storage instruction :

Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing

quality control testing :

Antibody Reactive Against Recombinant Protein

type clonality :

Antibody

raised in host species :

Mouse

antigen species target species :

Human

species reactivity cross reactivity :

Human,Rat

application key :

WB-Ce,ELISA,WB-Re,WB-Tr,IP

size :

100 ug

autodate :

2006-10-10

updatetime :

2013-11-15 18:29:55

more info or order :

Abnova product webpage