This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
IL31RA monoclonal antibody (M02), clone 3C9
catalog :
H00133396-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3C9
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00133396-M02
product name :
IL31RA monoclonal antibody (M02), clone 3C9
product description :
Mouse monoclonal antibody raised against a partial recombinant IL31RA.
clone name :
3C9
isotype :
IgG2a Kappa
gene name :
IL31RA
gene alias :
CRL CRL3 GLM-R GLMR GPL IL-31RA MGC125346 PRO21384
gene description :
interleukin 31 receptor A
genbank accession :
NM_139017
immunogen :
IL31RA (NP_620586, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
LPAKPENISCVYYYRKNLTCTWSPGKETSYTQYTVKRTY
AFGEKHDNCTTNSSTSENRASCSFFLPRITIPDNYTIEV
EAENGDGVIKSHMTYWRLENIA
AFGEKHDNCTTNSSTSENRASCSFFLPRITIPDNYTIEV
EAENGDGVIKSHMTYWRLENIA
protein accession :
NP_620586
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2010-04-26
updatetime :
2013-11-15 18:46:22
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
