This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
IL17F MaxPab rabbit polyclonal antibody (D01)
catalog :
H00112744-D01
quantity :
100 uL
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunoprecipitation
product information
catalog id :
H00112744-D01
product name :
IL17F MaxPab rabbit polyclonal antibody (D01)
product description :
Rabbit polyclonal antibody raised against a full-length human IL17F protein.
gene name :
IL17F
gene alias :
IL-17F ML-1 ML1
gene description :
interleukin 17F
genbank accession :
NM_052872
immunogen :
IL17F (NP_443104.1, 1 a.a. ~ 163 a.a) full-length human protein.
immunogen sequence protein sequence :
MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHT
FFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRS
TSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDIS
MNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVT
PVIHHVQ
FFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRS
TSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDIS
MNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVT
PVIHHVQ
protein accession :
NP_443104.1
storage buffer :
No additive
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,WB-Tr,IP
size :
100 uL
autodate :
2010-03-01
updatetime :
2010-04-16 01:01:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
