This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PDCD1LG2 monoclonal antibody (M10), clone 1F6
catalog :
H00080380-M10
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1F6
reactivity :
human
product information
catalog id :
H00080380-M10
product name :
PDCD1LG2 monoclonal antibody (M10), clone 1F6
product description :
Mouse monoclonal antibody raised against a partial recombinant PDCD1LG2.
clone name :
1F6
isotype :
IgG1 Kappa
gene name :
PDCD1LG2
gene alias :
B7DC Btdc CD273 MGC142238 MGC142240 PD-L2 PDCD1L2 PDL2 bA574F11.2
gene description :
programmed cell death 1 ligand 2
genbank accession :
BC074766.2
immunogen :
PDCD1LG2 (AAH74766.1, 19 a.a. ~ 121 a.a) partial recombinant protein.
immunogen sequence protein sequence :
ALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITA
SLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRD
EGQYQCIIIYGVAWDYKYLTLKVKA
SLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRD
EGQYQCIIIYGVAWDYKYLTLKVKA
protein accession :
AAH74766.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA
size :
100 ug
autodate :
2015-07-27
updatetime :
2017-09-05 15:48:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
