This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SLC30A5 monoclonal antibody (M03), clone 2E10
catalog :
H00064924-M03
quantity :
50 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2E10
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00064924-M03
product name :
SLC30A5 monoclonal antibody (M03), clone 2E10
product description :
Mouse monoclonal antibody raised against a full-length recombinant SLC30A5.
clone name :
2E10
isotype :
IgG2a Kappa
gene name :
SLC30A5
gene alias :
FLJ12496 FLJ12756 MGC5499 ZNT5 ZNTL1 ZTL1 ZnT-5
gene description :
solute carrier family 30 (zinc transporter), member 5
genbank accession :
BC000808
immunogen :
SLC30A5 (AAH00808.1, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFT
KFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQ
KPFSSGKTITKHQIIGSLKIPGRKEFKDKKLNDPRKLVG
N
KFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQ
KPFSSGKTITKHQIIGSLKIPGRKEFKDKKLNDPRKLVG
N
protein accession :
AAH00808.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re,WB-Tr
size :
50 ug
autodate :
2012-06-13
updatetime :
2013-11-15 18:48:17
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
