product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
HHIP monoclonal antibody (M01), clone 5D11
catalog :
H00064399-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
5D11
reactivity :
human
application :
western blot, ELISA, immunoprecipitation, immunohistochemistry - paraffin section
more info or order :
citations: 2
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
| |
product information
catalog id :
H00064399-M01
product name :
HHIP monoclonal antibody (M01), clone 5D11
product description :
Mouse monoclonal antibody raised against a partial recombinant HHIP.
clone name :
5D11
isotype :
IgG2b Kappa
gene name :
HHIP
gene alias :
FLJ20992 FLJ90230 HIP STQTL12
gene description :
hedgehog interacting protein
genbank accession :
NM_022475
immunogen :
HHIP (NP_071920, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQL
ELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVT
NNTECGKLLEEIKCALCSPHSQ
ELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVT
NNTECGKLLEEIKCALCSPHSQ
protein accession :
NP_071920
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IP,WB-Tr,S-ELISA,ELISA,WB-Re,WB-Ce,IHC-P
size :
100 ug
autodate :
10/10/06
updatetime :
11/15/13 18:29
more info or order :
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
related products
browse more products
questions and comments
