This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
JAM2 (Human) Recombinant Protein
catalog :
H00058494-G01
quantity :
10 ug
product information
catalog id :
H00058494-G01
product name :
JAM2 (Human) Recombinant Protein
product description :
Human JAM2 full-length ORF (NP_067042.1) recombinant protein without tag.
gene name :
JAM2
gene alias :
C21orf43 CD322 JAM-B JAMB PRO245 VE-JAM VEJAM
gene description :
junctional adhesion molecule 2
genbank accession :
NM_021219.2
immunogen sequence protein sequence :
MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVT
AVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQT
LQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQ
GQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQ
DKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTK
TGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDD
LNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSF
QKSNSSSKATTMSENDFKHTKSFII
AVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQT
LQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQ
GQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQ
DKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTK
TGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDD
LNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSF
QKSNSSSKATTMSENDFKHTKSFII
protein accession :
NP_067042.1
form :
Liquid
preparation method :
in vitro wheat germ expression system with proprietary liposome technology
recommend dilutions :
Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
storage buffer :
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
storage instruction :
Store at -80 C. Aliquot to avoid repeated freezing and thawing.
note :
Best use within three months from the date of receipt of this protein.
type clonality :
Protein
raised in host species :
Wheat Germ (in vitro)
antigen species target species :
Human
application key :
AP,Func,Screening
size :
10 ug
autodate :
2015-09-24
updatetime :
2017-08-11 17:31:40
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
