This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
MICAL3 monoclonal antibody (M08), clone 3A6
catalog :
H00057553-M08
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00057553-M08
product name :
MICAL3 monoclonal antibody (M08), clone 3A6
product description :
Mouse monoclonal antibody raised against a partial recombinant MICAL3.
clone name :
3A6
isotype :
IgG2a Kappa
gene name :
MICAL3
gene alias :
KIAA0819 MGC189703
gene description :
microtubule associated monoxygenase, calponin and LIM domain containing 3
genbank accession :
XM_032996
immunogen :
MICAL3 (XP_032996.2, 251 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
DDQHWSDSPSDADRELRLPCPAEGEAELELRVSEDEEKL
PASPKHQERGPSQATSPIRSPQESALLFIPVHSPSTEGP
QLPPVPAATQEK
PASPKHQERGPSQATSPIRSPQESALLFIPVHSPSTEGP
QLPPVPAATQEK
protein accession :
XP_032996.2
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,WB-Re,ELISA
size :
100 ug
autodate :
11/9/11
updatetime :
11/15/13 18:48
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
