This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
MTUS1 monoclonal antibody (M02A), clone 1C10
catalog :
H00057509-M02A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1C10
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00057509-M02A
product name :
MTUS1 monoclonal antibody (M02A), clone 1C10
product description :
Mouse monoclonal antibody raised against a full-length recombinant MTUS1.
clone name :
1C10
isotype :
IgM Kappa
gene name :
MTUS1
gene alias :
ATIP DKFZp586D1519 DKFZp686F20243 FLJ14295 KIAA1288 MP44 MTSG1
gene description :
mitochondrial tumor suppressor 1
genbank accession :
BC033842
immunogen :
MTUS1 (AAH33842, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MQLQEQFDNLNAAHETSKLEIEASHSEKLELLTKAYEAS
LSEIKKGHEIEKKSLEDLLSEKQESLEKQINDLKSENDA
LNEKLKSEEQKRRAREKANLKNPQIMYLEQELESLKAVL
EIKNEKLHQQDIKLMKMGKLVDNNTALVDKLKRFQQENE
ELKARMDKHMAISRQLSTEQAVLQESLEKESKVNKRLSM
ENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPS
PSISPR
protein accession :
AAH33842
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
200 uL
autodate :
2008-08-05
updatetime :
2012-01-13 16:44:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098