NDRG2 monoclonal antibody (M03), clone 6A5 | Abnova H00057447-M03 product information

product summary

company name :

Abnova

product type :

antibody

product name :

NDRG2 monoclonal antibody (M03), clone 6A5

catalog :

H00057447-M03

quantity :

100 ug

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

6A5

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry

more info or order :

Abnova product webpage

citations: 14

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry; mouse; loading ...; fig 2a western blot; human; 1:1000; loading ...; fig 3g	Shen L, Qu X, Li H, Xu C, Wei M, Wang Q, et al. NDRG2 facilitates colorectal cancer differentiation through the regulation of Skp2-p21/p27 axis. Oncogene. 2018;37:1759-1774 pubmed publisher
western blot; human	Shen L, Qu X, Ma Y, Zheng J, Chu D, Liu B, et al. Tumor suppressor NDRG2 tips the balance of oncogenic TGF-? via EMT inhibition in colorectal cancer. Oncogenesis. 2014;3:e86 pubmed publisher
	Langhi C, Pedraz Cuesta E, Donate Y, Marrero P, Haro D, Rodriguez J. Regulation of N-Myc downstream regulated gene 2 by bile acids. Biochem Biophys Res Commun. 2013;434:102-9 pubmed publisher
	Oh S, Kim D, Kim D, Chang H, Sohn K, Kim K, et al. NDRG2 correlated with favorable recurrence-free survival inhibits metastasis of mouse breast cancer cells via attenuation of active TGF-? production. Carcinogenesis. 2012;33:1882-8 pubmed publisher
	Liu X, Niu T, Liu X, Hou W, Zhang J, Yao L. Microarray profiling of HepG2 cells ectopically expressing NDRG2. Gene. 2012;503:48-55 pubmed publisher
	Li T, Hu J, He G, Li Y, Zhu C, Hou W, et al. Up-regulation of NDRG2 through nuclear factor-kappa B is required for Leydig cell apoptosis in both human and murine infertile testes. Biochim Biophys Acta. 2012;1822:301-13 pubmed publisher
	Song S, Zhang S, Liu R, Yao L, Hao Y, Liao M, et al. NDRG2 down-regulation and CD24 up-regulation promote tumor aggravation and poor survival in patients with gallbladder carcinoma. Med Oncol. 2012;29:1879-85 pubmed publisher
	Yang J, Zheng J, Wu L, Shi M, Zhang H, Wang X, et al. NDRG2 ameliorates hepatic fibrosis by inhibiting the TGF-?1/Smad pathway and altering the MMP2/TIMP2 ratio in rats. PLoS ONE. 2011;6:e27710 pubmed publisher
	Li L, Qin X, Shi M, Miao R, Wang L, Liu X, et al. Regulation of histone acetylation by NDRG2 in glioma cells. J Neurooncol. 2012;106:485-92 pubmed publisher
	Zheng J, Li Y, Yang J, Liu Q, Shi M, Zhang R, et al. NDRG2 inhibits hepatocellular carcinoma adhesion, migration and invasion by regulating CD24 expression. BMC Cancer. 2011;11:251:1-9 pubmed publisher
	Li Y, Shen L, Cai L, Wang Q, Hou W, Wang F, et al. Spatial-temporal expression of NDRG2 in rat brain after focal cerebral ischemia and reperfusion. Brain Res. 2011;1382:252-8 pubmed publisher
	Sun Z, Shen L, Sun X, Tong G, Sun D, Han T, et al. Variation of NDRG2 and c-Myc expression in rat heart during the acute stage of ischemia/reperfusion injury. Histochem Cell Biol. 2011;135:27-35 pubmed publisher
	Shen L, Liu X, Hou W, Yang G, Wu Y, Zhang R, et al. NDRG2 is highly expressed in pancreatic beta cells and involved in protection against lipotoxicity. Cell Mol Life Sci. 2010;67:1371-81 pubmed publisher
	Shen L, Zhao Z, Wang Y, Ji S, Liu X, Liu X, et al. Immunohistochemical detection of Ndrg2 in the mouse nervous system. Neuroreport. 2008;19:927-31 pubmed publisher

product information

catalog id :

H00057447-M03

product name :

NDRG2 monoclonal antibody (M03), clone 6A5

product description :

Mouse monoclonal antibody raised against a partial recombinant NDRG2.

clone name :

6A5

isotype :

IgG1 Kappa

gene name :

NDRG2

gene alias :

DKFZp781G1938 FLJ25522 KIAA1248 SYLD

gene description :

NDRG family member 2

genbank accession :

NM_016250

immunogen :

NDRG2 (NP_057334, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

immunogen sequence protein sequence :

MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFT
VYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEII
QNFVRVHVDAPGMEEGAP

protein accession :

NP_057334

storage buffer :

In 1x PBS, pH 7.4

storage instruction :

Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing

quality control testing :

Antibody Reactive Against Recombinant Protein

type clonality :

Antibody

raised in host species :

Mouse

antigen species target species :

Human

species reactivity cross reactivity :

Human

application key :

WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

size :

100 ug

autodate :

2007-07-12

updatetime :

2013-11-15 18:37:01

more info or order :

Abnova product webpage