SALL4 monoclonal antibody (M03), clone 6E3 | Abnova H00057167-M03 product information

product summary

company name :

Abnova

product type :

antibody

product name :

SALL4 monoclonal antibody (M03), clone 6E3

catalog :

H00057167-M03

quantity :

100 ug

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

6.00E+03

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry - paraffin section

more info or order :

Abnova product webpage

citations: 11

Published Application/Species/Sample/Dilution	Reference
western blot; human; fig 4	Bie Q, Sun C, Gong A, Li C, Su Z, Zheng D, et al. Non-tumor tissue derived interleukin-17B activates IL-17RB/AKT/Î²-catenin pathway to enhance the stemness of gastric cancer. Sci Rep. 2016;6:25447 pubmed publisher
immunohistochemistry - paraffin section; mouse; 1:100; fig 4	Okumura N, Akutsu H, Sugawara T, Miura T, Takezawa Y, Hosoda A, et al. ?-catenin functions pleiotropically in differentiation and tumorigenesis in mouse embryo-derived stem cells. PLoS ONE. 2013;8:e63265 pubmed publisher
	Agarwal A, Tunison K, Dalal J, Nagamma S, Hamra F, Sankella S, et al. Metabolic, Reproductive, and Neurologic Abnormalities in Agpat1-Null Mice. Endocrinology. 2017;158:3954-3973 pubmed publisher
	Ikeda H, Sato Y, Yoneda N, Harada K, Sasaki M, Kitamura S, et al. ?-Fetoprotein-producing gastric carcinoma and combined hepatocellular and cholangiocarcinoma show similar morphology but different histogenesis with respect to SALL4 expression. Hum Pathol. 2012;43:1955-63 pubmed publisher
	Iwamoto N, Ishida M, Yoshida K, Kagotani A, Iwai M, Okabe H. Mediastinal seminoma: a case report with special emphasis on SALL4 as a new immunocytochemical marker. Diagn Cytopathol. 2013;41:821-4 pubmed publisher
	Meguro S, Yasuda M. ?-Fetoprotein-producing ovarian tumor in a postmenopausal woman with germ cell differentiation. Ann Diagn Pathol. 2013;17:140-4 pubmed publisher
	Clark P, Polosukhina D, Love H, Correa H, Coffin C, Perlman E, et al. ?-Catenin and K-RAS synergize to form primitive renal epithelial tumors with features of epithelial Wilms' tumors. Am J Pathol. 2011;179:3045-55 pubmed publisher
	Deisch J, Raisanen J, Rakheja D. Immunoexpression of SALL4 in Wilms tumors and developing kidney. Pathol Oncol Res. 2011;17:639-44 pubmed publisher
	Sangoi A, Karamchandani J, Lane B, Higgins J, Rouse R, Brooks J, et al. Specificity of brachyury in the distinction of chordoma from clear cell renal cell carcinoma and germ cell tumors: a study of 305 cases. Mod Pathol. 2011;24:425-9 pubmed publisher
	Forte A, Schettino M, Finicelli M, Cipollaro M, Colacurci N, Cobellis L, et al. Expression pattern of stemness-related genes in human endometrial and endometriotic tissues. Mol Med. 2009;15:392-401 pubmed publisher
	Cauffman G, De Rycke M, Sermon K, Liebaers I, Van de Velde H. Markers that define stemness in ESC are unable to identify the totipotent cells in human preimplantation embryos. Hum Reprod. 2009;24:63-70 pubmed publisher

product information

catalog id :

H00057167-M03

product name :

SALL4 monoclonal antibody (M03), clone 6E3

product description :

Mouse monoclonal antibody raised against a partial recombinant SALL4.

clone name :

6.00E+03

isotype :

IgG1 Kappa

gene name :

SALL4

gene alias :

DRRS HSAL4 MGC133050 ZNF797 dJ1112F19.1

gene description :

sal-like 4 (Drosophila)

genbank accession :

NM_020436

immunogen :

SALL4 (NP_065169, 954 a.a. ~ 1053 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

immunogen sequence protein sequence :

PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQS
GGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPS
ATDGVPKHQFPHFLEENKIAVS

protein accession :

NP_065169

storage buffer :

In 1x PBS, pH 7.4

storage instruction :

Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing

quality control testing :

Antibody Reactive Against Recombinant Protein

type clonality :

Antibody

raised in host species :

Mouse

antigen species target species :

Human

species reactivity cross reactivity :

Human,Mouse

application key :

S-ELISA,ELISA,WB-Re,IHC-P

size :

100 ug

autodate :

10/10/06

updatetime :

11/15/13 18:29

more info or order :

Abnova product webpage