product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
TMEPAI monoclonal antibody (M01), clone 2A12
catalog :
H00056937-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2A12
reactivity :
human, mouse
application :
western blot, ELISA, flow cytometry
more info or order :
citations: 6
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
| |
| Li H, Mohamed A, Sharad S, Umeda E, Song Y, Young D, et al. Silencing of PMEPA1 accelerates the growth of prostate cancer cells through AR, NEDD4 and PTEN. Oncotarget. 2015;6:15137-49 pubmed
|
product information
catalog id :
H00056937-M01
product name :
TMEPAI monoclonal antibody (M01), clone 2A12
product description :
Mouse monoclonal antibody raised against a partial recombinant TMEPAI.
clone name :
2A12
isotype :
IgG2a Kappa
gene name :
PMEPA1
gene alias :
STAG1 TMEPAI
gene description :
prostate transmembrane protein, androgen induced 1
genbank accession :
BC015918
immunogen :
TMEPAI (AAH15918, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
NRTIFDSDLMDSARLGGPCPPSSNSGISATCYGSGGRME
GPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTH
IAPLESAAIWSKEKDKQKGHPL
GPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTH
IAPLESAAIWSKEKDKQKGHPL
protein accession :
AAH15918
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
more info or order :
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
related products
browse more products
- DUSP22 purified MaxPab mouse polyclonal antibody (B01P) | H00056940-B01P
- DUSP22 MaxPab rabbit polyclonal antibody (D01) | H00056940-D01
- DUSP22 purified MaxPab rabbit polyclonal antibody (D01P) | H00056940-D01P
- DUSP22 monoclonal antibody (M01), clone 3D3 | H00056940-M01
- MRPS22 monoclonal antibody (M10), clone 1E1 | H00056945-M10
questions and comments
