product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
EIF5A2 monoclonal antibody (M01), clone 1E7
catalog :
H00056648-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1E7
reactivity :
human
application :
western blot, ELISA, immunohistochemistry
more info or order :
citations: 1
product information
catalog id :
H00056648-M01
product name :
EIF5A2 monoclonal antibody (M01), clone 1E7
product description :
Mouse monoclonal antibody raised against a partial recombinant EIF5A2.
clone name :
1E7
isotype :
IgG1 Kappa
gene name :
EIF5A2
gene alias :
EIF-5A2 eIF5AII
gene description :
eukaryotic translation initiation factor 5A2
genbank accession :
NM_020390
immunogen :
EIF5A2 (NP_065123, 66 a.a. ~ 153 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
GKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTE
TGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSE
EYAVAIKPCK
TGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSE
EYAVAIKPCK
protein accession :
NP_065123
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re,WB-Tr
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
more info or order :
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
related products
browse more products
questions and comments
