This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
MMP26 monoclonal antibody (M02), clone 3B9
catalog :
H00056547-M02
quantity :
50 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3B9
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
product information
catalog id :
H00056547-M02
product name :
MMP26 monoclonal antibody (M02), clone 3B9
product description :
Mouse monoclonal antibody raised against a partial recombinant MMP26.
clone name :
3B9
isotype :
IgG1 Kappa
gene name :
MMP26
gene alias :
MGC126590 MGC126592
gene description :
matrix metallopeptidase 26
genbank accession :
NM_021801
immunogen :
MMP26 (NP_068573, 152 a.a. ~ 261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
SFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKN
EHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPT
YWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP
EHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPT
YWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP
protein accession :
NP_068573
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,S-ELISA,ELISA,WB-Re
size :
50 ug
autodate :
1/25/10
updatetime :
11/15/13 18:46
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
