This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PARD3 monoclonal antibody (M03), clone 4G5
catalog :
H00056288-M03
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00056288-M03
product name :
PARD3 monoclonal antibody (M03), clone 4G5
product description :
Mouse monoclonal antibody raised against a partial recombinant PARD3.
clone name :
4G5
isotype :
IgG2a Kappa
gene name :
PARD3
gene alias :
ASIP Baz Bazooka FLJ21015 PAR3 PAR3alpha PARD3A SE2-5L16 SE2-5LT1 SE2-5T2
gene description :
par-3 partitioning defective 3 homolog (C. elegans)
genbank accession :
BC011711
immunogen :
PARD3 (AAH11711, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
KIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARER
DYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSP
REGHMMDALYAQVKKPRNSKPSPVDSNRSTPS
DYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSP
REGHMMDALYAQVKKPRNSKPSPVDSNRSTPS
protein accession :
AAH11711
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
7/20/09
updatetime :
11/15/13 18:43
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
