This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CTNNBL1 monoclonal antibody (M01A), clone 5F1
catalog :
H00056259-M01A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
5F1
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00056259-M01A
product name :
CTNNBL1 monoclonal antibody (M01A), clone 5F1
product description :
Mouse monoclonal antibody raised against a partial recombinant CTNNBL1.
clone name :
5F1
isotype :
IgG3 Kappa
gene name :
CTNNBL1
gene alias :
C20orf33 FLJ21108 NAP NYD-SP19 P14L PP8304 dJ633O20.1
gene description :
catenin, beta like 1
genbank accession :
BC036739
immunogen :
CTNNBL1 (AAH36739, 210 a.a. ~ 311 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
EKHDMVRRGEIIDNDTEEEFYLRRLDAGLFVLQHICYIM
AEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAEN
IGDGRSPEFRENEQKRILGLLENF
AEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAEN
IGDGRSPEFRENEQKRILGLLENF
protein accession :
AAH36739
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,ELISA,WB-Re
size :
200 uL
autodate :
2011-06-30
updatetime :
2012-01-05 19:00:38
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
