product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
DCP1A monoclonal antibody (M06), clone 3G4
catalog :
H00055802-M06
quantity :
50 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3G4
reactivity :
human, mouse
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - frozen section
more info or order :
citations: 24
Published Application/Species/Sample/DilutionReference
  • immunohistochemistry - frozen section; mouse; 1:200; fig 4
Kato Y, Katsuki T, Kokubo H, Masuda A, Saga Y. Dazl is a target RNA suppressed by mammalian NANOS2 in sexually differentiating male germ cells. Nat Commun. 2016;7:11272 pubmed publisher
  • immunocytochemistry; mouse; fig 6e
Amadei G, Zander M, Yang G, Dumelie J, Vessey J, Lipshitz H, et al. A Smaug2-Based Translational Repression Complex Determines the Balance between Precursor Maintenance versus Differentiation during Mammalian Neurogenesis. J Neurosci. 2015;35:15666-81 pubmed publisher
  • immunocytochemistry; human
Ling Y, Wong C, Li K, Chan K, Boukamp P, Liu W. CCHCR1 interacts with EDC4, suggesting its localization in P-bodies. Exp Cell Res. 2014;327:12-23 pubmed publisher
  • immunocytochemistry; human; 1:400
Kaehler C, Isensee J, Hucho T, Lehrach H, Krobitsch S. 5-Fluorouracil affects assembly of stress granules based on RNA incorporation. Nucleic Acids Res. 2014;42:6436-47 pubmed publisher
  • immunohistochemistry; mouse
Lachke S, Alkuraya F, Kneeland S, Ohn T, Aboukhalil A, Howell G, et al. Mutations in the RNA granule component TDRD7 cause cataract and glaucoma. Science. 2011;331:1571-6 pubmed publisher
Le Voyer T, Neehus A, Yang R, Ogishi M, Rosain J, Alroqi F, et al. Inherited deficiency of stress granule ZNFX1 in patients with monocytosis and mycobacterial disease. Proc Natl Acad Sci U S A. 2021;118: pubmed publisher
Haeusler A, Donnelly C, Periz G, Simko E, Shaw P, Kim M, et al. C9orf72 nucleotide repeat structures initiate molecular cascades of disease. Nature. 2014;507:195-200 pubmed publisher
Lee H, Komano J, Saitoh Y, Yamaoka S, Kozaki T, Misawa T, et al. Zinc-finger antiviral protein mediates retinoic acid inducible gene I-like receptor-independent antiviral response to murine leukemia virus. Proc Natl Acad Sci U S A. 2013;110:12379-84 pubmed publisher
Cohen Katsenelson K, Wasserman T, Darlyuk Saadon I, Rabner A, Glaser F, Aronheim A. Identification and analysis of a novel dimerization domain shared by various members of c-Jun N-terminal kinase (JNK) scaffold proteins. J Biol Chem. 2013;288:7294-304 pubmed publisher
Wang C, Chen W, Wang S. Pdc1 functions in the assembly of P bodies in Schizosaccharomyces pombe. Mol Cell Biol. 2013;33:1244-53 pubmed publisher
Li Y, Chen R, Zhou Q, Xu Z, Li C, Wang S, et al. LSm14A is a processing body-associated sensor of viral nucleic acids that initiates cellular antiviral response in the early phase of viral infection. Proc Natl Acad Sci U S A. 2012;109:11770-5 pubmed publisher
Thomas M, Luchelli L, Pascual M, Gottifredi V, Boccaccio G. A monoclonal antibody against p53 cross-reacts with processing bodies. PLoS ONE. 2012;7:e36447 pubmed publisher
Kobayashi T, Winslow S, Sunesson L, Hellman U, Larsson C. PKC? binds G3BP2 and regulates stress granule formation following cellular stress. PLoS ONE. 2012;7:e35820 pubmed publisher
Osugi K, Suzuki H, Nomura T, Ariumi Y, Shibata H, Maki M. Identification of the P-body component PATL1 as a novel ALG-2-interacting protein by in silico and far-Western screening of proline-rich proteins. J Biochem. 2012;151:657-66 pubmed publisher
Baez M, Luchelli L, Maschi D, Habif M, Pascual M, Thomas M, et al. Smaug1 mRNA-silencing foci respond to NMDA and modulate synapse formation. J Cell Biol. 2011;195:1141-57 pubmed publisher
Yu S, Lujan P, Jackson D, Emerman M, Linial M. The DEAD-box RNA helicase DDX6 is required for efficient encapsidation of a retroviral genome. PLoS Pathog. 2011;7:e1002303 pubmed publisher
Shih J, Wang W, Tsai T, Kuo C, Li H, Wu Lee Y. Critical roles of RNA helicase DDX3 and its interactions with eIF4E/PABP1 in stress granule assembly and stress response. Biochem J. 2012;441:119-29 pubmed publisher
Rzeczkowski K, Beuerlein K, Müller H, Dittrich Breiholz O, Schneider H, Kettner Buhrow D, et al. c-Jun N-terminal kinase phosphorylates DCP1a to control formation of P bodies. J Cell Biol. 2011;194:581-96 pubmed publisher
Li Y, Song M, Kiledjian M. Differential utilization of decapping enzymes in mammalian mRNA decay pathways. RNA. 2011;17:419-28 pubmed publisher
Suzuki A, Igarashi K, Aisaki K, Kanno J, Saga Y. NANOS2 interacts with the CCR4-NOT deadenylation complex and leads to suppression of specific RNAs. Proc Natl Acad Sci U S A. 2010;107:3594-9 pubmed publisher
Aravin A, van der Heijden G, Castañeda J, Vagin V, Hannon G, Bortvin A. Cytoplasmic compartmentalization of the fetal piRNA pathway in mice. PLoS Genet. 2009;5:e1000764 pubmed publisher
Wasserman T, Katsenelson K, Daniliuc S, Hasin T, Choder M, Aronheim A. A novel c-Jun N-terminal kinase (JNK)-binding protein WDR62 is recruited to stress granules and mediates a nonclassical JNK activation. Mol Biol Cell. 2010;21:117-30 pubmed publisher
Beaudoin S, Vanderperre B, Grenier C, Tremblay I, Leduc F, Roucou X. A large ribonucleoprotein particle induced by cytoplasmic PrP shares striking similarities with the chromatoid body, an RNA granule predicted to function in posttranscriptional gene regulation. Biochim Biophys Acta. 2009;1793:335-45 pubmed publisher
Aizer A, Brody Y, Ler L, Sonenberg N, Singer R, Shav Tal Y. The dynamics of mammalian P body transport, assembly, and disassembly in vivo. Mol Biol Cell. 2008;19:4154-66 pubmed publisher
product information
catalog id :
H00055802-M06
product name :
DCP1A monoclonal antibody (M06), clone 3G4
product description :
Mouse monoclonal antibody raised against a partial recombinant DCP1A.
clone name :
3G4
isotype :
IgG2a Kappa
gene name :
DCP1A
gene alias :
FLJ21691 HSA275986 Nbla00360 SMAD4IP1 SMIF
gene description :
DCP1 decapping enzyme homolog A (S. cerevisiae)
genbank accession :
NM_018403
immunogen :
DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFG
TSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFE
QLGGAPQSETLGVPSAAHHSVQ
protein accession :
NP_060873
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re,IF
size :
50 ug
autodate :
4/18/08
updatetime :
11/15/13 18:40
more info or order :
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098