This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name : 
Abnova
product type : 
antibody
product name : 
DCP1A polyclonal antibody (A01)
catalog : 
H00055802-A01
quantity : 
50 uL
clonality : 
polyclonal
host : 
mouse
conjugate : 
nonconjugated
reactivity : 
human, mouse
application : 
western blot, ELISA
product information
catalog id : 
H00055802-A01
product name : 
DCP1A polyclonal antibody (A01)
product description : 
Mouse polyclonal antibody raised against a partial recombinant DCP1A.
gene name : 
DCP1A
gene alias : 
FLJ21691 HSA275986 Nbla00360 SMAD4IP1 SMIF
gene description : 
DCP1 decapping enzyme homolog A (S. cerevisiae)
genbank accession : 
NM_018403
immunogen : 
DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag.
immunogen sequence protein sequence : 
STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFG
TSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFE
QLGGAPQSETLGVPSAAHHSVQ
TSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFE
QLGGAPQSETLGVPSAAHHSVQ
protein accession : 
NP_060873
storage buffer : 
50 % glycerol
storage instruction : 
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing : 
Antibody Reactive Against Recombinant Protein
type clonality : 
Antibody
raised in host species : 
Mouse
antigen species target species : 
Human
species reactivity cross reactivity : 
Human,Mouse
application key : 
WB-Ce,ELISA,WB-Re
size : 
50 uL
autodate : 
2006-10-11
updatetime : 
2012-02-16 10:09:06
company information
Abnova
9th Fl., No.108, Jhouzih St. 
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
