This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
OTUB1 monoclonal antibody (M09), clone 1C12
catalog :
H00055611-M09
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1C12
reactivity :
human
application :
western blot, ELISA
citations: 1
product information
catalog id :
H00055611-M09
product name :
OTUB1 monoclonal antibody (M09), clone 1C12
product description :
Mouse monoclonal antibody raised against a full-length recombinant OTUB1.
clone name :
1C12
isotype :
IgG2a Kappa
gene name :
OTUB1
gene alias :
FLJ20113 FLJ40710 HSPC263 MGC111158 MGC4584 OTB1 OTU1
gene description :
OTU domain, ubiquitin aldehyde binding 1
genbank accession :
BC007519
immunogen :
OTUB1 (AAH07519, 1 a.a. ~ 271 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MAAEEPQQQKQEPLGSDSEGVNCLAYDEANMAQQDRIQQ
EIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKK
YSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAV
SAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVA
DLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIE
GGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVE
YMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK
EIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKK
YSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAV
SAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVA
DLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIE
GGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVE
YMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK
protein accession :
AAH07519
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,S-ELISA,ELISA
size :
100 ug
autodate :
2008-05-23
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
