This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
MARCH1 monoclonal antibody (M02), clone 3D2
catalog :
H00055016-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3D2
reactivity :
human
product information
catalog id :
H00055016-M02
product name :
MARCH1 monoclonal antibody (M02), clone 3D2
product description :
Mouse monoclonal antibody raised against a partial recombinant MARCH1.
clone name :
3D2
isotype :
IgG2a Kappa
gene name :
1-Mar
gene alias :
DKFZp564M1682 FLJ20668 MARCH-I RNF171
gene description :
membrane-associated ring finger (C3HC4) 1
genbank accession :
NM_017923
immunogen :
MARCH1 (NP_060393, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MTSSHVCCNFLNMWKKSKISTMYYLNQDAKLSNLFLQAS
SPTTGTAPRSQSRLSVCPSTQDICRICHCEGDEESPLIT
PCRCTGTLRFVHQSCLHQWIK
SPTTGTAPRSQSRLSVCPSTQDICRICHCEGDEESPLIT
PCRCTGTLRFVHQSCLHQWIK
protein accession :
NP_060393
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA
size :
100 ug
autodate :
10/25/06
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
