This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
IMPAD1 (Human) Recombinant Protein (P01)
catalog :
H00054928-P01
quantity :
10 ug,25 ug
product information
catalog id :
H00054928-P01
product name :
IMPAD1 (Human) Recombinant Protein (P01)
product description :
Human IMPAD1 full-length ORF ( AAH17797.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.
gene name :
IMPAD1
gene alias :
FLJ20421 IMPA3
gene description :
inositol monophosphatase domain containing 1
genbank accession :
BC017797.1
immunogen sequence protein sequence :
MAPMGIRLSPLGVAVFCLLGLGVLYHLYSGFLAGRFSLF
GLGGEPGGGAAGPAAAADGGTVDLREMLAVSVLAAVRGG
DEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKM
FYLLKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILK
EVTTPKEVPAESVTVWIDPLDATQEYTEDLRKYVTTMVC
VAVNGKPMLGVIHKPFSEYTAWAMVDGGSNVKARSSYNE
KTPRIVVSRSHSGMVKQVALQTFGNQTTIIPAGGAGYKV
LALLDVPDKSQEKADLYIHVTYIKKWDICAGNAILKALG
GHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLP
DLEKTGHK
GLGGEPGGGAAGPAAAADGGTVDLREMLAVSVLAAVRGG
DEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKM
FYLLKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILK
EVTTPKEVPAESVTVWIDPLDATQEYTEDLRKYVTTMVC
VAVNGKPMLGVIHKPFSEYTAWAMVDGGSNVKARSSYNE
KTPRIVVSRSHSGMVKQVALQTFGNQTTIIPAGGAGYKV
LALLDVPDKSQEKADLYIHVTYIKKWDICAGNAILKALG
GHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLP
DLEKTGHK
protein accession :
AAH17797.1
preparation method :
in vitro wheat germ expression system
storage buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
storage instruction :
Store at -80 C. Aliquot to avoid repeated freezing and thawing.
quality control testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
note :
Best use within three months from the date of receipt of this protein.
tag :
GST
type clonality :
Protein
raised in host species :
Wheat Germ (in vitro)
antigen species target species :
Human
application key :
WB-Re,ELISA,Array,AP
size :
10 ug,25 ug
autodate :
12/29/08
updatetime :
10/18/13 19:06
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
